PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625923.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 146aa    MW: 16655.6 Da    PI: 9.4859
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625923.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1084.7e-343290159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                    ldDg++WrKYGqK+vkg+++prsYYrCt++gC+v+k+ver++ dpk+v++tYeg+Hnh+
  XP_009625923.1 32 LDDGFKWRKYGQKVVKGNHHPRSYYRCTYPGCNVRKHVERASADPKAVITTYEGKHNHD 90
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.7E-371892IPR003657WRKY domain
SuperFamilySSF1182901.7E-302492IPR003657WRKY domain
PROSITE profilePS5081135.8982792IPR003657WRKY domain
SMARTSM007741.2E-393291IPR003657WRKY domain
PfamPF031069.5E-273390IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
CRKTAVEAPN LASSHKSESK IVVQTRSEVD ILDDGFKWRK YGQKVVKGNH HPRSYYRCTY  60
PGCNVRKHVE RASADPKAVI TTYEGKHNHD IPIARNRGHS TAQDSTRQLN EQDVATWRPS  120
LHENVAFHNT NEIPVCRQLK EEQIAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-402392877Probable WRKY transcription factor 4
2lex_A2e-402392877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111350.0AB711135.1 Nicotiana benthamiana NbWRKY14 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625923.11e-107PREDICTED: probable WRKY transcription factor 58, partial
SwissprotQ9ZQ705e-45WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A0P0UVQ88e-97A0A0P0UVQ8_NICBE; Transcription factor
STRINGPGSC0003DMT4000142204e-82(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1745334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.13e-46WRKY DNA-binding protein 3